Class b: All beta proteins [48724] (174 folds) |
Fold b.19: Viral protein domain [49817] (1 superfamily) sandwich; 9 strands in 2 sheets; jelly-roll; form trimers |
Superfamily b.19.1: Viral protein domain [49818] (3 families) forms homotrimers |
Family b.19.1.2: Influenza hemagglutinin headpiece [49823] (2 proteins) |
Protein Hemagglutinin [49824] (5 species) includes rudiment esterase domain |
Species Influenza A virus, different strains [TaxId:11320] [49825] (54 PDB entries) |
Domain d1hgfa_: 1hgf A: [23813] Other proteins in same PDB: d1hgfb_, d1hgfd_, d1hgff_ complexed with nag |
PDB Entry: 1hgf (more details), 3 Å
SCOPe Domain Sequences for d1hgfa_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1hgfa_ b.19.1.2 (A:) Hemagglutinin {Influenza A virus, different strains [TaxId: 11320]} qdlpgndnstatlclghhavpngtlvktitddqievtnatelvqssstgkicnnphrild gidctlidallgdphcdvfqnetwdlfverskafsncypydvpdyaslrslvassgtlef itegftwtgvtqnggsnackrgpgsgffsrlnwltksgstypvlnvtmpnndnfdklyiw gihhpstnqeqtslyvqasgrvtvstrrsqqtiipnigsrpwvrglssrisiywtivkpg dvlvinsngnliaprgyfkmrtgkssimrsdapidtcisecitpngsipndkpfqnvnki tygacpkyvkqntlklatgmrnvpekqt
Timeline for d1hgfa_: