SCOPe 2.01: Domain d1hgfa_: 1hgf A:

Lineage for d1hgfa_ (1hgf A:)

1. Root: SCOPe 2.01

2. Class b: All beta proteins [48724] (174 folds)

3. Fold b.19: Viral protein domain [49817] (1 superfamily)
   sandwich; 9 strands in 2 sheets; jelly-roll; form trimers

4. Superfamily b.19.1: Viral protein domain [49818] (3 families)
   forms homotrimers

5. Family b.19.1.2: Influenza hemagglutinin headpiece [49823] (2 proteins)

6. Protein Hemagglutinin [49824] (5 species)
   includes rudiment esterase domain

7. Species Influenza A virus, different strains [TaxId:11320] [49825] (54 PDB entries)

8. Domain d1hgfa_: 1hgf A: [23813]
   Other proteins in same PDB: d1hgfb_, d1hgfd_, d1hgff_
   complexed with nag

Details for d1hgfa_

PDB Entry: 1hgf, 3 Å

PDB Description: binding of influenza virus hemagglutinin to analogs of its cell- surface receptor, sialic acid: analysis by proton nuclear magnetic resonance spectroscopy and x-ray crystallography

PDB Compounds: (A:) hemagglutinin, chain ha1

SCOPe Domain Sequences for d1hgfa_:

Sequence; same for both SEQRES and ATOM records:

>d1hgfa_ b.19.1.2 (A:) Hemagglutinin {Influenza A virus, different strains [TaxId: 11320]}
qdlpgndnstatlclghhavpngtlvktitddqievtnatelvqssstgkicnnphrild
gidctlidallgdphcdvfqnetwdlfverskafsncypydvpdyaslrslvassgtlef
itegftwtgvtqnggsnackrgpgsgffsrlnwltksgstypvlnvtmpnndnfdklyiw
gihhpstnqeqtslyvqasgrvtvstrrsqqtiipnigsrpwvrglssrisiywtivkpg
dvlvinsngnliaprgyfkmrtgkssimrsdapidtcisecitpngsipndkpfqnvnki
tygacpkyvkqntlklatgmrnvpekqt

Timeline for d1hgfa_:

• d1hgfa_ first appeared (with stable ids) in SCOP 1.55
  
• d1hgfa_ appears in SCOP 1.75
  
• d1hgfa_ appears in SCOPe 2.02
  
• d1hgfa_ appears in the current release, SCOPe 2.08