Lineage for d1hgfa_ (1hgf A:)

  1. Root: SCOP 1.55
  2. 6992Class b: All beta proteins [48724] (93 folds)
  3. 12156Fold b.19: Segmented RNA-genome viruses' proteins [49817] (1 superfamily)
  4. 12157Superfamily b.19.1: Segmented RNA-genome viruses' proteins [49818] (3 families) (S)
  5. 12184Family b.19.1.2: Influenza hemagglutinin headpice [49823] (1 protein)
  6. 12185Protein Hemagglutinin [49824] (1 species)
  7. 12186Species Influenza A virus, different strains [TaxId:11320] [49825] (18 PDB entries)
  8. 12217Domain d1hgfa_: 1hgf A: [23813]
    Other proteins in same PDB: d1hgfb_, d1hgfd_, d1hgff_

Details for d1hgfa_

PDB Entry: 1hgf (more details), 3 Å

PDB Description: binding of influenza virus hemagglutinin to analogs of its cell- surface receptor, sialic acid: analysis by proton nuclear magnetic resonance spectroscopy and x-ray crystallography

SCOP Domain Sequences for d1hgfa_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1hgfa_ b.19.1.2 (A:) Hemagglutinin {Influenza A virus, different strains}
qdlpgndnstatlclghhavpngtlvktitddqievtnatelvqssstgkicnnphrild
gidctlidallgdphcdvfqnetwdlfverskafsncypydvpdyaslrslvassgtlef
itegftwtgvtqnggsnackrgpgsgffsrlnwltksgstypvlnvtmpnndnfdklyiw
gihhpstnqeqtslyvqasgrvtvstrrsqqtiipnigsrpwvrglssrisiywtivkpg
dvlvinsngnliaprgyfkmrtgkssimrsdapidtcisecitpngsipndkpfqnvnki
tygacpkyvkqntlklatgmrnvpekqt

SCOP Domain Coordinates for d1hgfa_:

Click to download the PDB-style file with coordinates for d1hgfa_.
(The format of our PDB-style files is described here.)

Timeline for d1hgfa_: