![]() | Class g: Small proteins [56992] (94 folds) |
![]() | Fold g.17: Cystine-knot cytokines [57500] (1 superfamily) disulfide-rich fold; common core is all-beta |
![]() | Superfamily g.17.1: Cystine-knot cytokines [57501] (8 families) ![]() |
![]() | Family g.17.1.3: Neurotrophin [57520] (5 proteins) automatically mapped to Pfam PF00243 |
![]() | Protein beta-Nerve growth factor [57525] (2 species) |
![]() | Species Human (Homo sapiens) [TaxId:9606] [57527] (6 PDB entries) Uniprot P01138 |
![]() | Domain d4edxv_: 4edx V: [238123] Other proteins in same PDB: d4edxa1, d4edxa2, d4edxl1, d4edxl2 automated match to d1wwww_ |
PDB Entry: 4edx (more details), 2.5 Å
SCOPe Domain Sequences for d4edxv_:
Sequence, based on SEQRES records: (download)
>d4edxv_ g.17.1.3 (V:) beta-Nerve growth factor {Human (Homo sapiens) [TaxId: 9606]} gefsvcdsvsvwvgdkttatdikgkevmvlgevninnsvfkqyffetkcrdpnpvdsgcr gidskhwnsycttthtfvkaltmdgkqaawrfiridtacvcvlsrka
>d4edxv_ g.17.1.3 (V:) beta-Nerve growth factor {Human (Homo sapiens) [TaxId: 9606]} gefsvcdsvsvwvgdkttatdikgkevmvlgevninnsvfkqyffetkcrdgcrgidskh wnsycttthtfvkaltmdgkqaawrfiridtacvcvlsrka
Timeline for d4edxv_: