Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
Fold c.8: The "swivelling" beta/beta/alpha domain [52008] (10 superfamilies) 3 layers: b/b/a; the central sheet is parallel, and the other one is antiparallel; there are some variations in topology this domain is thought to be mobile in most multi-domain proteins known to contain it |
Superfamily c.8.8: Putative cyclase [102198] (2 families) contains mixed beta-sheet barrel, closed n=7, S=10 |
Family c.8.8.0: automated matches [238093] (1 protein) not a true family |
Protein automated matches [238095] (3 species) not a true protein |
Species Burkholderia cenocepacia [TaxId:216591] [238096] (1 PDB entry) |
Domain d4cogb_: 4cog B: [238109] automated match to d3krvb_ complexed with cd, edo, gol, mg, peg, zn |
PDB Entry: 4cog (more details), 1.6 Å
SCOPe Domain Sequences for d4cogb_:
Sequence; same for both SEQRES and ATOM records: (download)
>d4cogb_ c.8.8.0 (B:) automated matches {Burkholderia cenocepacia [TaxId: 216591]} tlwdisppvspatpvwpgdtpvavervwrmeagspvnvarltlsphtgahcdaplhydad gapigavpldtylgpcrvihcigaapvvrpadveaaldgvpprvllrtyaraaveqwdsn fcavapdtvdllaahgvkligidtpsldpqesktmdahrrvrahrmailegivlddvppg dyelialplkfatldaspvravlralp
Timeline for d4cogb_: