SCOPe 2.06: Domain d4coba_: 4cob A:

Lineage for d4coba_ (4cob A:)

1. Root: SCOPe 2.06

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.8: The "swivelling" beta/beta/alpha domain [52008] (10 superfamilies)
   3 layers: b/b/a; the central sheet is parallel, and the other one is antiparallel; there are some variations in topology
   this domain is thought to be mobile in most multi-domain proteins known to contain it

4. Superfamily c.8.8: Putative cyclase [102198] (2 families)
   contains mixed beta-sheet barrel, closed n=7, S=10

5. Family c.8.8.0: automated matches [238093] (1 protein)
   not a true family

6. Protein automated matches [238095] (3 species)
   not a true protein

7. Species Pseudomonas aeruginosa, PA01 [TaxId:208964] [238104] (1 PDB entry)

8. Domain d4coba_: 4cob A: [238106]
   automated match to d3krvb_
   complexed with zn

Details for d4coba_

PDB Entry: 4cob, 2.37 Å

PDB Description: crystal structure kynurenine formamidase from pseudomonas aeruginosa

PDB Compounds: (A:) kynurenine formamidase

SCOPe Domain Sequences for d4coba_:

Sequence; same for both SEQRES and ATOM records:

>d4coba_ c.8.8.0 (A:) automated matches {Pseudomonas aeruginosa, PA01 [TaxId: 208964]}
rywdispaldpntptwpgdtpfqqewaarldeqcpvnvgritlsphtgahvdgplhyrad
glpigqvpldvymgpcrvihciganplvtpehlagqlddlpsrvllrtfervpanwpegf
caiapatieclaergvrlvgidtpsldpqhsktldahhavgrhgmailegvvlddvpagd
yellalplkfthldaspvravlralp

Timeline for d4coba_:

• d4coba_ first appeared in SCOPe 2.03
  
• d4coba_ appears in SCOPe 2.05
  
• d4coba_ appears in SCOPe 2.07
  
• d4coba_ appears in the current release, SCOPe 2.08