Lineage for d4cohb_ (4coh B:)

  1. Root: SCOPe 2.06
  2. 1976409Class a: All alpha proteins [46456] (289 folds)
  3. 2004931Fold a.104: Cytochrome P450 [48263] (1 superfamily)
    multihelical
  4. 2004932Superfamily a.104.1: Cytochrome P450 [48264] (2 families) (S)
  5. 2005528Family a.104.1.0: automated matches [191509] (1 protein)
    not a true family
  6. 2005529Protein automated matches [190847] (63 species)
    not a true protein
  7. 2005985Species Trypanosoma cruzi [TaxId:5693] [196511] (10 PDB entries)
  8. 2005991Domain d4cohb_: 4coh B: [238103]
    automated match to d3khma_
    complexed with hem, t9h

Details for d4cohb_

PDB Entry: 4coh (more details), 2.08 Å

PDB Description: Crystal structure of Trypanosoma cruzi CYP51 bound to the sulfonamide derivative of the 4-aminopyridyl-based inhibitor
PDB Compounds: (B:) Sterol 14-alpha demethylase

SCOPe Domain Sequences for d4cohb_:

Sequence, based on SEQRES records: (download)

>d4cohb_ a.104.1.0 (B:) automated matches {Trypanosoma cruzi [TaxId: 5693]}
ptdppvypvtvpflghivqfgknplefmqrckrdlksgvftisiggqrvtivgdphehsr
ffsprneilsprevytimtpvfgegvayaapyprmreqlnflaeeltiakfqnfvpaiqh
evrkfmaenwkedegvinlledcgamiintacqclfgedlrkrlnarhfaqllskmessl
ipaavfmpwllrlplpqsarcrearaelqkilgeiivarekeeaskdnntsdllggllka
vyrdgtrmslhevcgmivaamfagqhtstittswsmlhlmhpknkkwldklhkeidefpa
qlnydnvmdempfaercvresirrdppllmvmrmvkaevkvgsyvvpkgdiiacspllsh
hdeeafpnprlwdperdekvdgafigfgagvhkcigqkfallqvktilatafreydfqll
rdevpdpdyhtmvvgptlnqclvkytrkkklp

Sequence, based on observed residues (ATOM records): (download)

>d4cohb_ a.104.1.0 (B:) automated matches {Trypanosoma cruzi [TaxId: 5693]}
ptdppvypvtvpflghivqfgknplefmqrckrdlksgvftisiggqrvtivgdphehsr
ffsprneilsprevytimtpvfgegvayaapyprmreqlnflaeeltiakfqnfvpaiqh
evrkfmaenwkedegvinlledcgamiintacqclfgedlrkrlnarhfaqllskmessl
ipaavfmpwllrlplpqsarcrearaelqkilgeiivareketsdllggllkavyrdgtr
mslhevcgmivaamfagqhtstittswsmlhlmhpknkkwldklhkeidefpaqlnydnv
mdempfaercvresirrdppllmvmrmvkaevkvgsyvvpkgdiiacspllshhdeeafp
nprlwdperdekvdgafigfgagvhkcigqkfallqvktilatafreydfqllrdevpdp
dyhtmvvgptlnqclvkytrkkklp

SCOPe Domain Coordinates for d4cohb_:

Click to download the PDB-style file with coordinates for d4cohb_.
(The format of our PDB-style files is described here.)

Timeline for d4cohb_: