Lineage for d4cafa1 (4caf A:27-210)

  1. Root: SCOPe 2.08
  2. 2923792Class d: Alpha and beta proteins (a+b) [53931] (396 folds)
  3. 2968378Fold d.108: Acyl-CoA N-acyltransferases (Nat) [55728] (1 superfamily)
    3 layers: a/b/a; contains mixed beta-sheet
  4. 2968379Superfamily d.108.1: Acyl-CoA N-acyltransferases (Nat) [55729] (12 families) (S)
  5. 2968970Family d.108.1.0: automated matches [191308] (1 protein)
    not a true family
  6. 2968971Protein automated matches [190038] (49 species)
    not a true protein
  7. 2969271Species Plasmodium vivax [TaxId:5855] [234134] (20 PDB entries)
  8. 2969281Domain d4cafa1: 4caf A:27-210 [238089]
    automated match to d1iica1
    complexed with 370, cl, dms, mg, nh4, nhw, so4

Details for d4cafa1

PDB Entry: 4caf (more details), 1.7 Å

PDB Description: Plasmodium vivax N-myristoyltransferase in complex with a benzothiophene inhibitor (compound 34a)
PDB Compounds: (A:) Glycylpeptide N-tetradecanoyltransferase

SCOPe Domain Sequences for d4cafa1:

Sequence; same for both SEQRES and ATOM records: (download)

>d4cafa1 d.108.1.0 (A:27-210) automated matches {Plasmodium vivax [TaxId: 5855]}
dykfwytqpvpkindefnesvnepfisdnkvedvrkdeyklppgyswyvcdvkdekdrse
iytlltdnyvedddnifrfnysaefllwaltspnylktwhigvkydasnkligfisaipt
dicihkrtikmaevnflcvhktlrskrlapvlikeitrrinleniwqaiytagvylpkpv
sdar

SCOPe Domain Coordinates for d4cafa1:

Click to download the PDB-style file with coordinates for d4cafa1.
(The format of our PDB-style files is described here.)

Timeline for d4cafa1: