Lineage for d4c9xa_ (4c9x A:)

  1. Root: SCOPe 2.08
  2. 2923792Class d: Alpha and beta proteins (a+b) [53931] (396 folds)
  3. 2971307Fold d.113: Nudix [55810] (1 superfamily)
    beta(2)-alpha-beta(3)-alpha; 3 layers: alpha/beta/alpha; mixed sheet
    contains beta-grasp motif
  4. 2971308Superfamily d.113.1: Nudix [55811] (8 families) (S)
  5. 2971309Family d.113.1.1: MutT-like [55812] (17 proteins)
  6. 2971606Protein automated matches [190465] (6 species)
    not a true protein
  7. 2971623Species Human (Homo sapiens) [TaxId:9606] [189707] (13 PDB entries)
  8. 2971624Domain d4c9xa_: 4c9x A: [238084]
    automated match to d1irya_
    complexed with cl, so4, vhs

Details for d4c9xa_

PDB Entry: 4c9x (more details), 1.2 Å

PDB Description: crystal structure of nudt1 (mth1) with s-crizotinib
PDB Compounds: (A:) 7,8-dihydro-8-oxoguanine triphosphatase

SCOPe Domain Sequences for d4c9xa_:

Sequence; same for both SEQRES and ATOM records: (download)

>d4c9xa_ d.113.1.1 (A:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
asrlytlvlvlqpqrvllgmkkrgfgagrwngfggkvqegetiedgarrelqeesgltvd
alhkvgqivfefvgepelmdvhvfctdsiqgtpvesdemrpcwfqldqipfkdmwpddsy
wfplllqkkkfhgyfkfqgqdtildytlrevdtv

SCOPe Domain Coordinates for d4c9xa_:

Click to download the PDB-style file with coordinates for d4c9xa_.
(The format of our PDB-style files is described here.)

Timeline for d4c9xa_: