Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
Fold c.37: P-loop containing nucleoside triphosphate hydrolases [52539] (1 superfamily) 3 layers: a/b/a, parallel or mixed beta-sheets of variable sizes |
Superfamily c.37.1: P-loop containing nucleoside triphosphate hydrolases [52540] (26 families) division into families based on beta-sheet topologies |
Family c.37.1.0: automated matches [191323] (1 protein) not a true family |
Protein automated matches [190123] (130 species) not a true protein |
Species Pyrococcus furiosus [TaxId:186497] [238073] (1 PDB entry) |
Domain d3whke1: 3whk E:169-429 [238075] Other proteins in same PDB: d3whka2, d3whkb2, d3whkc2, d3whkd2, d3whke2, d3whkf2, d3whkg2, d3whkh2 automated match to d2qz4a_ complexed with atp |
PDB Entry: 3whk (more details), 2.6 Å
SCOPe Domain Sequences for d3whke1:
Sequence, based on SEQRES records: (download)
>d3whke1 c.37.1.0 (E:169-429) automated matches {Pyrococcus furiosus [TaxId: 186497]} gfevverpnvtyndigglkkqlqelreaielplkhpelfeevgidppkgvllygppgcgk tlmakaiahevnatfirvvgselvrkyigegarlvhelfelakekaptiifideidaiga krldettggerevnrtlmqllaemdgfdprgnvkviaatnrpdildpallrpgrfdrlie vplpdefsraqilqihsrkmttdddinwqelarstdefngaqlkavtveagmialrngqs svkhedfvegisevqarksks
>d3whke1 c.37.1.0 (E:169-429) automated matches {Pyrococcus furiosus [TaxId: 186497]} gfevverpnvtyndigglkkqlqelreaielplkhpelfeevgidppkgvllygppgcgk tlmakaiahevnatfirvvgselvegarlvhelfelakekaptiifideidaigakevnr tlmqllaemdgfdprgnvkviaatnrpdildpallrpgrfdrlievplpdefsraqilqi hsrkmttdddinwqelarstdefngaqlkavtveagmialrngqssvkhedfvegisevq arksks
Timeline for d3whke1: