Lineage for d3whke1 (3whk E:169-429)

  1. Root: SCOPe 2.06
  2. 2078559Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2109203Fold c.37: P-loop containing nucleoside triphosphate hydrolases [52539] (1 superfamily)
    3 layers: a/b/a, parallel or mixed beta-sheets of variable sizes
  4. 2109204Superfamily c.37.1: P-loop containing nucleoside triphosphate hydrolases [52540] (26 families) (S)
    division into families based on beta-sheet topologies
  5. 2113903Family c.37.1.0: automated matches [191323] (1 protein)
    not a true family
  6. 2113904Protein automated matches [190123] (130 species)
    not a true protein
  7. 2114634Species Pyrococcus furiosus [TaxId:186497] [238073] (1 PDB entry)
  8. 2114639Domain d3whke1: 3whk E:169-429 [238075]
    Other proteins in same PDB: d3whka2, d3whkb2, d3whkc2, d3whkd2, d3whke2, d3whkf2, d3whkg2, d3whkh2
    automated match to d2qz4a_
    complexed with atp

Details for d3whke1

PDB Entry: 3whk (more details), 2.6 Å

PDB Description: crystal structure of pan-rpt5c chimera
PDB Compounds: (E:) Proteasome-activating nucleotidase, 26S protease regulatory subunit 6A

SCOPe Domain Sequences for d3whke1:

Sequence, based on SEQRES records: (download)

>d3whke1 c.37.1.0 (E:169-429) automated matches {Pyrococcus furiosus [TaxId: 186497]}
gfevverpnvtyndigglkkqlqelreaielplkhpelfeevgidppkgvllygppgcgk
tlmakaiahevnatfirvvgselvrkyigegarlvhelfelakekaptiifideidaiga
krldettggerevnrtlmqllaemdgfdprgnvkviaatnrpdildpallrpgrfdrlie
vplpdefsraqilqihsrkmttdddinwqelarstdefngaqlkavtveagmialrngqs
svkhedfvegisevqarksks

Sequence, based on observed residues (ATOM records): (download)

>d3whke1 c.37.1.0 (E:169-429) automated matches {Pyrococcus furiosus [TaxId: 186497]}
gfevverpnvtyndigglkkqlqelreaielplkhpelfeevgidppkgvllygppgcgk
tlmakaiahevnatfirvvgselvegarlvhelfelakekaptiifideidaigakevnr
tlmqllaemdgfdprgnvkviaatnrpdildpallrpgrfdrlievplpdefsraqilqi
hsrkmttdddinwqelarstdefngaqlkavtveagmialrngqssvkhedfvegisevq
arksks

SCOPe Domain Coordinates for d3whke1:

Click to download the PDB-style file with coordinates for d3whke1.
(The format of our PDB-style files is described here.)

Timeline for d3whke1: