Class b: All beta proteins [48724] (178 folds) |
Fold b.55: PH domain-like barrel [50728] (3 superfamilies) barrel, partly opened; n*=6, S*=12; meander; capped by an alpha-helix |
Superfamily b.55.1: PH domain-like [50729] (14 families) |
Family b.55.1.10: SSRP1-like [141436] (2 proteins) Pfam PF03531; Structure-specific recognition protein family; duplication: comprises tandem repeat of two domains of this fold |
Protein automated matches [190657] (2 species) not a true protein |
Species Baker's yeast (Saccharomyces cerevisiae) [TaxId:559292] [238070] (1 PDB entry) |
Domain d4pq0a_: 4pq0 A: [238071] automated match to d2gcjc_ complexed with mla |
PDB Entry: 4pq0 (more details), 1.65 Å
SCOPe Domain Sequences for d4pq0a_:
Sequence, based on SEQRES records: (download)
>d4pq0a_ b.55.1.10 (A:) automated matches {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 559292]} adigevagdaivsfqdvffttprgrydidiyknsirlrgktyeyklqhrqiqrivslpka ddihhllvlaiepplrqgqttypflvlqfqkdeetevqlnlededyeenykdklkkqyda kthivlshvlkgltdrrvivpgeykskydqcavscsfkanegylypldnafffltkptly ipfsdvsmvnisragqtstssrtfdlevvlrsnrgsttfaniskeeqqlleqflksknlr vk
>d4pq0a_ b.55.1.10 (A:) automated matches {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 559292]} adigevagdaivsfqdvffttprgrydidiyknsirlrgktyeyklqhrqiqrivslpka ddihhllvlaiepplrqgqttypflvlqfqkdeetevqlnlededyeenykdklkkqyda kthivlshvlkgltdrrvivpgeykskydqcavscsfkanegylypldnafffltkptly ipfsdvsmvnisrtfdlevvlrsnrgsttfaniskeeqqlleqflksknlrvk
Timeline for d4pq0a_: