Lineage for d4pq0a_ (4pq0 A:)

  1. Root: SCOPe 2.06
  2. 2017114Class b: All beta proteins [48724] (177 folds)
  3. 2061576Fold b.55: PH domain-like barrel [50728] (2 superfamilies)
    barrel, partly opened; n*=6, S*=12; meander; capped by an alpha-helix
  4. 2061577Superfamily b.55.1: PH domain-like [50729] (14 families) (S)
  5. 2062109Family b.55.1.10: SSRP1-like [141436] (2 protein domains)
    Pfam PF03531; Structure-specific recognition protein family; duplication: comprises tandem repeat of two domains of this fold
  6. 2062117Protein automated matches [190657] (2 species)
    not a true protein
  7. 2062120Species Baker's yeast (Saccharomyces cerevisiae) [TaxId:559292] [238070] (1 PDB entry)
  8. 2062121Domain d4pq0a_: 4pq0 A: [238071]
    automated match to d2gcjc_
    complexed with mla

Details for d4pq0a_

PDB Entry: 4pq0 (more details), 1.65 Å

PDB Description: crystal structure of pob3 middle domain at 1.65a
PDB Compounds: (A:) FACT complex subunit POB3

SCOPe Domain Sequences for d4pq0a_:

Sequence, based on SEQRES records: (download)

>d4pq0a_ b.55.1.10 (A:) automated matches {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 559292]}
adigevagdaivsfqdvffttprgrydidiyknsirlrgktyeyklqhrqiqrivslpka
ddihhllvlaiepplrqgqttypflvlqfqkdeetevqlnlededyeenykdklkkqyda
kthivlshvlkgltdrrvivpgeykskydqcavscsfkanegylypldnafffltkptly
ipfsdvsmvnisragqtstssrtfdlevvlrsnrgsttfaniskeeqqlleqflksknlr
vk

Sequence, based on observed residues (ATOM records): (download)

>d4pq0a_ b.55.1.10 (A:) automated matches {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 559292]}
adigevagdaivsfqdvffttprgrydidiyknsirlrgktyeyklqhrqiqrivslpka
ddihhllvlaiepplrqgqttypflvlqfqkdeetevqlnlededyeenykdklkkqyda
kthivlshvlkgltdrrvivpgeykskydqcavscsfkanegylypldnafffltkptly
ipfsdvsmvnisrtfdlevvlrsnrgsttfaniskeeqqlleqflksknlrvk

SCOPe Domain Coordinates for d4pq0a_:

Click to download the PDB-style file with coordinates for d4pq0a_.
(The format of our PDB-style files is described here.)

Timeline for d4pq0a_: