Lineage for d2visc_ (2vis C:)

  1. Root: SCOP 1.65
  2. 287094Class b: All beta proteins [48724] (126 folds)
  3. 294066Fold b.19: Viral protein domain [49817] (1 superfamily)
    sandwich; 9 strands in 2 sheets; jelly-roll; form trimers
  4. 294067Superfamily b.19.1: Viral protein domain [49818] (3 families) (S)
    forms homotrimers
  5. 294097Family b.19.1.2: Influenza hemagglutinin headpice [49823] (1 protein)
  6. 294098Protein Hemagglutinin [49824] (1 species)
    includes rudiment esterase domain
  7. 294099Species Influenza A virus, different strains [TaxId:11320] [49825] (25 PDB entries)
  8. 294131Domain d2visc_: 2vis C: [23807]
    Other proteins in same PDB: d2visa1, d2visa2, d2visb1, d2visb2
    complexed with nag, zn; mutant

Details for d2visc_

PDB Entry: 2vis (more details), 3.25 Å

PDB Description: influenza virus hemagglutinin, (escape) mutant with thr 131 replaced by ile, complexed with a neutralizing antibody
PDB Compounds: (C:)

SCOP Domain Sequences for d2visc_:

Sequence; same for both SEQRES and ATOM records: (download)

>d2visc_ b.19.1.2 (C:) Hemagglutinin {Influenza A virus, different strains}
vqssstgkicnnphrildgidctlidallgdphcdvfqnetwdlfverskafsncypydv
pdyaslrslvassgtlefitegftwtgviqnggsnackrgpgsgffsrlnwltksgstyp
vlnvtmpnndnfdklyiwgihhpstnqeqtslyvqasgrvtvstrrsqqtiipnigsrpw
vrglssrisiywtivkpgdvlvinsngnliaprgyfkmrtgkssimrsdapidtciseci
tpngsipndkpfqnvnkitygacpkyv

SCOP Domain Coordinates for d2visc_:

Click to download the PDB-style file with coordinates for d2visc_.
(The format of our PDB-style files is described here.)

Timeline for d2visc_: