Lineage for d2visc_ (2vis C:)

  1. Root: SCOP 1.55
  2. 6992Class b: All beta proteins [48724] (93 folds)
  3. 12156Fold b.19: Segmented RNA-genome viruses' proteins [49817] (1 superfamily)
  4. 12157Superfamily b.19.1: Segmented RNA-genome viruses' proteins [49818] (3 families) (S)
  5. 12184Family b.19.1.2: Influenza hemagglutinin headpice [49823] (1 protein)
  6. 12185Protein Hemagglutinin [49824] (1 species)
  7. 12186Species Influenza A virus, different strains [TaxId:11320] [49825] (18 PDB entries)
  8. 12212Domain d2visc_: 2vis C: [23807]
    Other proteins in same PDB: d2visa1, d2visa2, d2visb1, d2visb2

Details for d2visc_

PDB Entry: 2vis (more details), 3.25 Å

PDB Description: influenza virus hemagglutinin, (escape) mutant with thr 131 replaced by ile, complexed with a neutralizing antibody

SCOP Domain Sequences for d2visc_:

Sequence; same for both SEQRES and ATOM records: (download)

>d2visc_ b.19.1.2 (C:) Hemagglutinin {Influenza A virus, different strains}
vqssstgkicnnphrildgidctlidallgdphcdvfqnetwdlfverskafsncypydv
pdyaslrslvassgtlefitegftwtgviqnggsnackrgpgsgffsrlnwltksgstyp
vlnvtmpnndnfdklyiwgihhpstnqeqtslyvqasgrvtvstrrsqqtiipnigsrpw
vrglssrisiywtivkpgdvlvinsngnliaprgyfkmrtgkssimrsdapidtciseci
tpngsipndkpfqnvnkitygacpkyv

SCOP Domain Coordinates for d2visc_:

Click to download the PDB-style file with coordinates for d2visc_.
(The format of our PDB-style files is described here.)

Timeline for d2visc_: