SCOPe 2.03: Domain d4ov2a_: 4ov2 A:

Lineage for d4ov2a_ (4ov2 A:)

1. Root: SCOPe 2.03

2. Class a: All alpha proteins [46456] (284 folds)

3. Fold a.39: EF Hand-like [47472] (4 superfamilies)
   core: 4 helices; array of 2 hairpins, opened

4. Superfamily a.39.1: EF-hand [47473] (12 families)
   Duplication: consists of two EF-hand units: each is made of two helices connected with calcium-binding loop

5. Family a.39.1.0: automated matches [191396] (1 protein)
   not a true family

6. Protein automated matches [190513] (10 species)
   not a true protein

7. Species Rattus norvegicus [TaxId:10116] [238064] (1 PDB entry)

8. Domain d4ov2a_: 4ov2 A: [238066]
   automated match to d1dgua_
   complexed with ca

Details for d4ov2a_

PDB Entry: 4ov2, 2.6 Å

PDB Description: Crystal structure of C-terminally truncated Neuronal Calcium Sensor (NCS-1) from Rattus norvegicus

PDB Compounds: (A:) neuronal calcium sensor 1

SCOPe Domain Sequences for d4ov2a_:

Sequence, based on SEQRES records:

>d4ov2a_ a.39.1.0 (A:) automated matches {Rattus norvegicus [TaxId: 10116]}
ltrktyftekevqqwykgfikdcpsgqldaagfqkiykqffpfgdptkfatfvfnvfden
kdgriefsefiqalsvtsrgtldeklrwafklydldndgyitrnemldivdaiyqmvgnt
velpeeentpekrvdrifammdknadgkltlqefqegsk

Sequence, based on observed residues (ATOM records):

>d4ov2a_ a.39.1.0 (A:) automated matches {Rattus norvegicus [TaxId: 10116]}
ltrktyftekevqqwykgfikdcpsgqldaagfqkiykqffpfgdptkfatfvfnvfden
kdgriefsefiqalsvtsrgtldeklrwafklydldndgyitrnemldivdaiyqmvgnt
tpekrvdrifammdknadgkltlqefqegsk

Timeline for d4ov2a_:

• d4ov2a_ is new in SCOPe 2.03-stable
  
• d4ov2a_ appears in SCOPe 2.04
  
• d4ov2a_ appears in the current release, SCOPe 2.08