Lineage for d4orza_ (4orz A:)

  1. Root: SCOPe 2.05
  2. 1755445Class b: All beta proteins [48724] (176 folds)
  3. 1783288Fold b.34: SH3-like barrel [50036] (21 superfamilies)
    barrel, partly opened; n*=4, S*=8; meander
    the last strand is interrupted by a turn of 3-10 helix
  4. 1783415Superfamily b.34.2: SH3-domain [50044] (2 families) (S)
  5. 1783856Family b.34.2.0: automated matches [191375] (1 protein)
    not a true family
  6. 1783857Protein automated matches [190457] (8 species)
    not a true protein
  7. 1783907Species Human (Homo sapiens) [TaxId:9606] [187598] (88 PDB entries)
  8. 1783945Domain d4orza_: 4orz A: [238063]
    Other proteins in same PDB: d4orzb_, d4orzc_
    automated match to d1awwa_

Details for d4orza_

PDB Entry: 4orz (more details), 2 Å

PDB Description: HIV-1 Nef protein in complex with single domain antibody sdAb19 and an engineered Hck SH3 domain
PDB Compounds: (A:) Tyrosine-protein kinase HCK

SCOPe Domain Sequences for d4orza_:

Sequence; same for both SEQRES and ATOM records: (download)

>d4orza_ b.34.2.0 (A:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
iivvalydyyspfswdlsfqkgdqmvvleesgewwkarslatrkegyipsnyvarv

SCOPe Domain Coordinates for d4orza_:

Click to download the PDB-style file with coordinates for d4orza_.
(The format of our PDB-style files is described here.)

Timeline for d4orza_: