![]() | Class d: Alpha and beta proteins (a+b) [53931] (388 folds) |
![]() | Fold d.102: Regulatory factor Nef [55670] (1 superfamily) alpha(2)-beta(4)-alpha; 3 layers: alpha/beta/alpha |
![]() | Superfamily d.102.1: Regulatory factor Nef [55671] (2 families) ![]() |
![]() | Family d.102.1.1: Regulatory factor Nef [55672] (2 proteins) automatically mapped to Pfam PF00469 |
![]() | Protein automated matches [191288] (2 species) not a true protein |
![]() | Species Hiv-1 m:b_arv2/sf2 [TaxId:11685] [189936] (4 PDB entries) |
![]() | Domain d4orzb_: 4orz B: [238062] Other proteins in same PDB: d4orza_, d4orzc_ automated match to d2nefa_ |
PDB Entry: 4orz (more details), 2 Å
SCOPe Domain Sequences for d4orzb_:
Sequence; same for both SEQRES and ATOM records: (download)
>d4orzb_ d.102.1.1 (B:) automated matches {Hiv-1 m:b_arv2/sf2 [TaxId: 11685]} gfpvrpqvplrpmtykaaldishflkekgglegliwsqrrqeildlwiyhtqgyfpdwqn ytpgpgirypltfgwcfklvpvepekvdaekevlvwrfdsklafhhmarelhpeyyk
Timeline for d4orzb_: