Lineage for d4orzb_ (4orz B:)

  1. Root: SCOPe 2.08
  2. 2923792Class d: Alpha and beta proteins (a+b) [53931] (396 folds)
  3. 2967561Fold d.102: Regulatory factor Nef [55670] (1 superfamily)
    alpha(2)-beta(4)-alpha; 3 layers: alpha/beta/alpha
  4. 2967562Superfamily d.102.1: Regulatory factor Nef [55671] (2 families) (S)
  5. 2967563Family d.102.1.1: Regulatory factor Nef [55672] (2 proteins)
    automatically mapped to Pfam PF00469
  6. 2967572Protein automated matches [191288] (2 species)
    not a true protein
  7. 2967573Species Hiv-1 m:b_arv2/sf2 [TaxId:11685] [189936] (4 PDB entries)
  8. 2967576Domain d4orzb_: 4orz B: [238062]
    Other proteins in same PDB: d4orza_, d4orzc_
    automated match to d2nefa_

Details for d4orzb_

PDB Entry: 4orz (more details), 2 Å

PDB Description: HIV-1 Nef protein in complex with single domain antibody sdAb19 and an engineered Hck SH3 domain
PDB Compounds: (B:) Protein Nef

SCOPe Domain Sequences for d4orzb_:

Sequence; same for both SEQRES and ATOM records: (download)

>d4orzb_ d.102.1.1 (B:) automated matches {Hiv-1 m:b_arv2/sf2 [TaxId: 11685]}
gfpvrpqvplrpmtykaaldishflkekgglegliwsqrrqeildlwiyhtqgyfpdwqn
ytpgpgirypltfgwcfklvpvepekvdaekevlvwrfdsklafhhmarelhpeyyk

SCOPe Domain Coordinates for d4orzb_:

Click to download the PDB-style file with coordinates for d4orzb_.
(The format of our PDB-style files is described here.)

Timeline for d4orzb_: