SCOPe 2.08: Domain d4ojta1: 4ojt A:2-230

Lineage for d4ojta1 (4ojt A:2-230)

1. Root: SCOPe 2.08

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.56: Phosphorylase/hydrolase-like [53162] (8 superfamilies)
   core: 3 layers, a/b/a ; mixed sheet of 5 strands: order 21354; strand 4 is antiparallel to the rest; contains crossover loops

4. Superfamily c.56.2: Purine and uridine phosphorylases [53167] (2 families)
   complex architecture; contains mixed beta-sheet of 8 strands, order 23415867, strands 3, 6 & 7 are antiparallel to the rest; and barrel, closed; n=5, S=8

5. Family c.56.2.0: automated matches [191488] (1 protein)
   not a true family

6. Protein automated matches [190781] (46 species)
   not a true protein

7. Species Helicobacter pylori [TaxId:85962] [227827] (10 PDB entries)

8. Domain d4ojta1: 4ojt A:2-230 [238061]
   Other proteins in same PDB: d4ojta2
   automated match to d4bmza_
   complexed with 2wp, ade

Details for d4ojta1

PDB Entry: 4ojt, 1.5 Å

PDB Description: helicobacter pylori mtan complexed with s-ribosylhomocysteine and adenine

PDB Compounds: (A:) MTA/SAH nucleosidase

SCOPe Domain Sequences for d4ojta1:

Sequence; same for both SEQRES and ATOM records:

>d4ojta1 c.56.2.0 (A:2-230) automated matches {Helicobacter pylori [TaxId: 85962]}
qkigilgamreeitpilelfgvdfeeiplggnvfhkgvyhnkeiivayskigkvhstltt
tsmilafgvqkvlfsgvagslvkdlkindllvatqlvqhdvdlsafdhplgfipesaifi
etsgslnalakkianeqhialkegviasgdqfvhskerkeflvsefkasavemegasvaf
vcqkfgvpccvlrsisdnadekagmsfdefleksahtsakflksmvdel

Timeline for d4ojta1:

• d4ojta1 first appeared in SCOPe 2.03, called d4ojta_
  
• d4ojta1 appears in SCOPe 2.07