Lineage for d1hghe_ (1hgh E:)

  1. Root: SCOP 1.57
  2. 51639Class b: All beta proteins [48724] (104 folds)
  3. 57292Fold b.19: Viral protein domain [49817] (1 superfamily)
  4. 57293Superfamily b.19.1: Viral protein domain [49818] (3 families) (S)
  5. 57323Family b.19.1.2: Influenza hemagglutinin headpice [49823] (1 protein)
  6. 57324Protein Hemagglutinin [49824] (1 species)
  7. 57325Species Influenza A virus, different strains [TaxId:11320] [49825] (24 PDB entries)
  8. 57349Domain d1hghe_: 1hgh E: [23806]
    Other proteins in same PDB: d1hghb_, d1hghd_, d1hghf_

Details for d1hghe_

PDB Entry: 1hgh (more details), 2.7 Å

PDB Description: binding of influenza virus hemagglutinin to analogs of its cell- surface receptor, sialic acid: analysis by proton nuclear magnetic resonance spectroscopy and x-ray crystallography

SCOP Domain Sequences for d1hghe_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1hghe_ b.19.1.2 (E:) Hemagglutinin {Influenza A virus, different strains}
qdlpgndnstatlclghhavpngtlvktitddqievtnatelvqssstgkicnnphrild
gidctlidallgdphcdvfqnetwdlfverskafsncypydvpdyaslrslvassgtlef
itegftwtgvtqnggsnackrgpgsgffsrlnwltksgstypvlnvtmpnndnfdklyiw
gihhpstnqeqtslyvqasgrvtvstrrsqqtiipnigsrpwvrglssrisiywtivkpg
dvlvinsngnliaprgyfkmrtgkssimrsdapidtcisecitpngsipndkpfqnvnki
tygacpkyvkqntlklatgmrnvpekqt

SCOP Domain Coordinates for d1hghe_:

Click to download the PDB-style file with coordinates for d1hghe_.
(The format of our PDB-style files is described here.)

Timeline for d1hghe_: