SCOPe 2.07: Domain d4o2lb_: 4o2l B:

Lineage for d4o2lb_ (4o2l B:)

1. Root: SCOPe 2.07

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.37: P-loop containing nucleoside triphosphate hydrolases [52539] (1 superfamily)
   3 layers: a/b/a, parallel or mixed beta-sheets of variable sizes

4. Superfamily c.37.1: P-loop containing nucleoside triphosphate hydrolases [52540] (26 families)
   division into families based on beta-sheet topologies

5. Family c.37.1.0: automated matches [191323] (1 protein)
   not a true family

6. Protein automated matches [190123] (156 species)
   not a true protein

7. Species Mouse (Mus musculus) [TaxId:10090] [186847] (22 PDB entries)

8. Domain d4o2lb_: 4o2l B: [238057]
   automated match to d4k81f_
   complexed with act, gtp, mg, trs; mutant

Details for d4o2lb_

PDB Entry: 4o2l, 2.4 Å

PDB Description: Structure of Mus musculus Rheb G63A mutant bound to GTP

PDB Compounds: (B:) GTP-binding protein Rheb

SCOPe Domain Sequences for d4o2lb_:

Sequence; same for both SEQRES and ATOM records:

>d4o2lb_ c.37.1.0 (B:) automated matches {Mouse (Mus musculus) [TaxId: 10090]}
qsksrkiailgyrsvgkssltiqfvegqfvdsydptientftklitvngqeyhlqlvdta
aqdeysifpqtysidingyilvysvtsiksfevikvihgklldmvgkvqipimlvgnkkd
lhmervisyeegkalaeswnaaflessakenqtavdvfkriileaek

Timeline for d4o2lb_:

• d4o2lb_ first appeared in SCOPe 2.03
  
• d4o2lb_ appears in SCOPe 2.06
  
• d4o2lb_ appears in the current release, SCOPe 2.08