Lineage for d4o2ra_ (4o2r A:)

  1. Root: SCOPe 2.03
  2. 1336837Class c: Alpha and beta proteins (a/b) [51349] (147 folds)
  3. 1362078Fold c.37: P-loop containing nucleoside triphosphate hydrolases [52539] (1 superfamily)
    3 layers: a/b/a, parallel or mixed beta-sheets of variable sizes
  4. 1362079Superfamily c.37.1: P-loop containing nucleoside triphosphate hydrolases [52540] (25 families) (S)
    division into families based on beta-sheet topologies
  5. 1366119Family c.37.1.0: automated matches [191323] (1 protein)
    not a true family
  6. 1366120Protein automated matches [190123] (58 species)
    not a true protein
  7. 1366412Species Mouse (Mus musculus) [TaxId:10090] [186847] (7 PDB entries)
  8. 1366419Domain d4o2ra_: 4o2r A: [238054]
    automated match to d4k81f_
    complexed with gdp, mg; mutant

Details for d4o2ra_

PDB Entry: 4o2r (more details), 2.25 Å

PDB Description: Structure of Mus musculus Rheb G63V mutant bound to GDP
PDB Compounds: (A:) GTP-binding protein Rheb

SCOPe Domain Sequences for d4o2ra_:

Sequence; same for both SEQRES and ATOM records: (download)

>d4o2ra_ c.37.1.0 (A:) automated matches {Mouse (Mus musculus) [TaxId: 10090]}
qsksrkiailgyrsvgkssltiqfvegqfvdsydptientftklitvngqeyhlqlvdta
vqdeysifpqtysidingyilvysvtsiksfevikvihgklldmvgkvqipimlvgnkkd
lhmervisyeegkalaeswnaaflessakenqtavdvfkriileaek

SCOPe Domain Coordinates for d4o2ra_:

Click to download the PDB-style file with coordinates for d4o2ra_.
(The format of our PDB-style files is described here.)

Timeline for d4o2ra_: