SCOPe 2.08: Domain d4o25b_: 4o25 B:

Lineage for d4o25b_ (4o25 B:)

1. Root: SCOPe 2.08

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.37: P-loop containing nucleoside triphosphate hydrolases [52539] (1 superfamily)
   3 layers: a/b/a, parallel or mixed beta-sheets of variable sizes

4. Superfamily c.37.1: P-loop containing nucleoside triphosphate hydrolases [52540] (27 families)
   division into families based on beta-sheet topologies

5. Family c.37.1.0: automated matches [191323] (1 protein)
   not a true family

6. Protein automated matches [190123] (158 species)
   not a true protein

7. Species Mouse (Mus musculus) [TaxId:10090] [186847] (24 PDB entries)

8. Domain d4o25b_: 4o25 B: [238053]
   automated match to d4k81f_
   complexed with gtp, mg

Details for d4o25b_

PDB Entry: 4o25, 2.2 Å

PDB Description: Structure of Wild Type Mus musculus Rheb bound to GTP

PDB Compounds: (B:) GTP-binding protein Rheb

SCOPe Domain Sequences for d4o25b_:

Sequence; same for both SEQRES and ATOM records:

>d4o25b_ c.37.1.0 (B:) automated matches {Mouse (Mus musculus) [TaxId: 10090]}
qsksrkiailgyrsvgkssltiqfvegqfvdsydptientftklitvngqeyhlqlvdta
gqdeysifpqtysidingyilvysvtsiksfevikvihgklldmvgkvqipimlvgnkkd
lhmervisyeegkalaeswnaaflessakenqtavdvfkriileaek

Timeline for d4o25b_:

• d4o25b_ first appeared in SCOPe 2.03
  
• d4o25b_ appears in SCOPe 2.07