| Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
| Fold c.32: Tubulin nucleotide-binding domain-like [52489] (1 superfamily) 3 layers: a/b/a; parallel beta-sheet of 6 strands, order 321456 |
Superfamily c.32.1: Tubulin nucleotide-binding domain-like [52490] (2 families) ![]() automatically mapped to Pfam PF00091 |
| Family c.32.1.1: Tubulin, GTPase domain [52491] (4 proteins) |
| Protein automated matches [226837] (3 species) not a true protein |
| Species Cow (Bos taurus) [TaxId:9913] [226564] (14 PDB entries) |
| Domain d4o4lc1: 4o4l C:1-245 [238039] Other proteins in same PDB: d4o4la2, d4o4lb2, d4o4lc2, d4o4ld2, d4o4le_ automated match to d3ryha1 complexed with ca, ep, gdp, gtp, mes, mg, pou |
PDB Entry: 4o4l (more details), 2.2 Å
SCOPe Domain Sequences for d4o4lc1:
Sequence; same for both SEQRES and ATOM records: (download)
>d4o4lc1 c.32.1.1 (C:1-245) automated matches {Cow (Bos taurus) [TaxId: 9913]}
mrecisihvgqagvqignacwelyclehgiqpdgqmpsdktigggddsfntffsetgagk
hvpravfvdleptvidevrtgtyrqlfhpeqlitgkedaannyarghytigkeiidlvld
rirkladqctglqgflvfhsfgggtgsgftsllmerlsvdygkksklefsiypapqvsta
vvepynsiltthttlehsdcafmvdneaiydicrrnldierptytnlnrlisqivssita
slrfd
Timeline for d4o4lc1: