SCOPe 2.04: Domain d4o4lb2: 4o4l B:246-438

Lineage for d4o4lb2 (4o4l B:246-438)

1. Root: SCOPe 2.04

2. Class d: Alpha and beta proteins (a+b) [53931] (380 folds)

3. Fold d.79: Bacillus chorismate mutase-like [55297] (9 superfamilies)
   core: beta-alpha-beta-alpha-beta(2); mixed beta-sheet: order: 1423, strand 4 is antiparallel to the rest

4. Superfamily d.79.2: Tubulin C-terminal domain-like [55307] (2 families)

5. Family d.79.2.1: Tubulin, C-terminal domain [55308] (4 proteins)

6. Protein automated matches [227071] (2 species)
   not a true protein

7. Species Cow (Bos taurus) [TaxId:9913] [226565] (14 PDB entries)

8. Domain d4o4lb2: 4o4l B:246-438 [238038]
   Other proteins in same PDB: d4o4la1, d4o4lb1, d4o4lc1, d4o4ld1, d4o4le_
   automated match to d4i4td2
   complexed with ca, ep, gdp, gtp, mes, mg, pou

Details for d4o4lb2

PDB Entry: 4o4l, 2.2 Å

PDB Description: Tubulin-Peloruside A-Epothilone A complex

PDB Compounds: (B:) Tubulin beta-2B chain

SCOPe Domain Sequences for d4o4lb2:

Sequence; same for both SEQRES and ATOM records:

>d4o4lb2 d.79.2.1 (B:246-438) automated matches {Cow (Bos taurus) [TaxId: 9913]}
gqlnadlrklavnmvpfprlhffmpgfapltsrgsqqyraltvpeltqqmfdsknmmaac
dprhgryltvaaifrgrmsmkevdeqmlnvqnknssyfvewipnnvktavcdipprglkm
satfignstaiqelfkriseqftamfrrkaflhwytgegmdemefteaesnmndlvseyq
qyqda

Timeline for d4o4lb2:

• d4o4lb2 first appeared in SCOPe 2.03
  
• d4o4lb2 appears in SCOPe 2.05
  
• d4o4lb2 appears in the current release, SCOPe 2.08