SCOPe 2.04: Domain d4o4la1: 4o4l A:1-245

Lineage for d4o4la1 (4o4l A:1-245)

1. Root: SCOPe 2.04

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.32: Tubulin nucleotide-binding domain-like [52489] (1 superfamily)
   3 layers: a/b/a; parallel beta-sheet of 6 strands, order 321456

4. Superfamily c.32.1: Tubulin nucleotide-binding domain-like [52490] (2 families)
   automatically mapped to Pfam PF00091

5. Family c.32.1.1: Tubulin, GTPase domain [52491] (4 proteins)

6. Protein automated matches [226837] (3 species)
   not a true protein

7. Species Cow (Bos taurus) [TaxId:9913] [226564] (14 PDB entries)

8. Domain d4o4la1: 4o4l A:1-245 [238035]
   Other proteins in same PDB: d4o4la2, d4o4lb2, d4o4lc2, d4o4ld2, d4o4le_
   automated match to d3rycc1
   complexed with ca, ep, gdp, gtp, mes, mg, pou

Details for d4o4la1

PDB Entry: 4o4l, 2.2 Å

PDB Description: Tubulin-Peloruside A-Epothilone A complex

PDB Compounds: (A:) Tubulin alpha-1B chain

SCOPe Domain Sequences for d4o4la1:

Sequence; same for both SEQRES and ATOM records:

>d4o4la1 c.32.1.1 (A:1-245) automated matches {Cow (Bos taurus) [TaxId: 9913]}
mrecisihvgqagvqignacwelyclehgiqpdgqmpsdktigggddsfntffsetgagk
hvpravfvdleptvidevrtgtyrqlfhpeqlitgkedaannyarghytigkeiidlvld
rirkladqctglqgflvfhsfgggtgsgftsllmerlsvdygkksklefsiypapqvsta
vvepynsiltthttlehsdcafmvdneaiydicrrnldierptytnlnrlisqivssita
slrfd

Timeline for d4o4la1:

• d4o4la1 first appeared in SCOPe 2.03
  
• d4o4la1 appears in SCOPe 2.05
  
• d4o4la1 appears in the current release, SCOPe 2.08