![]() | Class a: All alpha proteins [46456] (286 folds) |
![]() | Fold a.29: Bromodomain-like [47363] (15 superfamilies) 4 helices; bundle; minor mirror variant of up-and-down topology |
![]() | Superfamily a.29.2: Bromodomain [47370] (2 families) ![]() |
![]() | Family a.29.2.0: automated matches [191428] (1 protein) not a true family |
![]() | Protein automated matches [190615] (7 species) not a true protein |
![]() | Species Plasmodium falciparum [TaxId:36329] [237857] (2 PDB entries) |
![]() | Domain d4nxjc_: 4nxj C: [238033] automated match to d4nxjb_ |
PDB Entry: 4nxj (more details), 2.18 Å
SCOPe Domain Sequences for d4nxjc_:
Sequence; same for both SEQRES and ATOM records: (download)
>d4nxjc_ a.29.2.0 (C:) automated matches {Plasmodium falciparum [TaxId: 36329]} gydeieelksknevltnllnkliafdkkriflypvnvqlvpdylnvikepmdfttmkqkl qnfkyksfqefekdvlliinncytyndpstiyykfaedietyykklnikiqtkymni
Timeline for d4nxjc_: