Lineage for d4nxjc_ (4nxj C:)

  1. Root: SCOPe 2.04
  2. 1473060Class a: All alpha proteins [46456] (285 folds)
  3. 1487717Fold a.29: Bromodomain-like [47363] (15 superfamilies)
    4 helices; bundle; minor mirror variant of up-and-down topology
  4. 1487718Superfamily a.29.2: Bromodomain [47370] (2 families) (S)
  5. 1487790Family a.29.2.0: automated matches [191428] (1 protein)
    not a true family
  6. 1487791Protein automated matches [190615] (4 species)
    not a true protein
  7. 1488069Species Plasmodium falciparum [TaxId:36329] [237857] (2 PDB entries)
  8. 1488074Domain d4nxjc_: 4nxj C: [238033]
    automated match to d4nxjb_

Details for d4nxjc_

PDB Entry: 4nxj (more details), 2.18 Å

PDB Description: crystal structure of pf3d7_1475600, a bromodomain from plasmodium falciparum
PDB Compounds: (C:) Bromodomain protein

SCOPe Domain Sequences for d4nxjc_:

Sequence; same for both SEQRES and ATOM records: (download)

>d4nxjc_ a.29.2.0 (C:) automated matches {Plasmodium falciparum [TaxId: 36329]}
gydeieelksknevltnllnkliafdkkriflypvnvqlvpdylnvikepmdfttmkqkl
qnfkyksfqefekdvlliinncytyndpstiyykfaedietyykklnikiqtkymni

SCOPe Domain Coordinates for d4nxjc_:

Click to download the PDB-style file with coordinates for d4nxjc_.
(The format of our PDB-style files is described here.)

Timeline for d4nxjc_: