Lineage for d4nwka_ (4nwk A:)

  1. Root: SCOPe 2.06
  2. 2021373Class b: All beta proteins [48724] (177 folds)
  3. 2064170Fold b.47: Trypsin-like serine proteases [50493] (1 superfamily)
    barrel, closed; n=6, S=8; greek-key
    duplication: consists of two domains of the same fold
  4. 2064171Superfamily b.47.1: Trypsin-like serine proteases [50494] (5 families) (S)
  5. 2066379Family b.47.1.3: Viral proteases [50596] (5 proteins)
    beta sheet in the first domain is opened rather than forms a barrel
  6. 2066469Protein automated matches [190658] (6 species)
    not a true protein
  7. 2066478Species Hepatitis C virus subtype 1a [TaxId:31646] [226463] (21 PDB entries)
  8. 2066489Domain d4nwka_: 4nwk A: [238032]
    automated match to d3sv8a_
    complexed with 2r8, gol, so4, zn

Details for d4nwka_

PDB Entry: 4nwk (more details), 1.62 Å

PDB Description: crystal structure of hepatis c virus protease (ns3) complexed with bms-605339 aka n-(tert-butoxycarbonyl)-3-me thyl-l-valyl-(4r)-n-((1r, 2s)-1-((cyclopropylsulfonyl)carba moyl)-2-vinylcyclopropyl)-4-((6- methoxy-1-isoquinolinyl)ox y)-l-prolinamide
PDB Compounds: (A:) HCV NS3 1a Protease

SCOPe Domain Sequences for d4nwka_:

Sequence; same for both SEQRES and ATOM records: (download)

>d4nwka_ b.47.1.3 (A:) automated matches {Hepatitis C virus subtype 1a [TaxId: 31646]}
gsvvivgrinlsgdtayaqqtrgeegcqetsqtgrdknqvegevqivstatqtflatsin
gvlwtvyhgagtrtiaspkgpvtqmytnvdkdlvgwqapqgsrsltpctcgssdlylvtr
hadvipvrrrgdsrgsllsprpisylkgssggpllcpaghavgifraavctrgvakavdf
ipveslet

SCOPe Domain Coordinates for d4nwka_:

Click to download the PDB-style file with coordinates for d4nwka_.
(The format of our PDB-style files is described here.)

Timeline for d4nwka_: