Lineage for d4nmha_ (4nmh A:)

  1. Root: SCOPe 2.05
  2. 1815291Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 1826588Fold c.2: NAD(P)-binding Rossmann-fold domains [51734] (1 superfamily)
    core: 3 layers, a/b/a; parallel beta-sheet of 6 strands, order 321456
    The nucleotide-binding modes of this and the next two folds/superfamilies are similar
  4. 1826589Superfamily c.2.1: NAD(P)-binding Rossmann-fold domains [51735] (13 families) (S)
  5. 1826923Family c.2.1.2: Tyrosine-dependent oxidoreductases [51751] (71 proteins)
    also known as short-chain dehydrogenases and SDR family
    parallel beta-sheet is extended by 7th strand, order 3214567; left-handed crossover connection between strands 6 and 7
  6. 1826950Protein 11-beta-hydroxysteroid dehydrogenase 1 [117423] (3 species)
  7. 1827072Species Mouse (Mus musculus) [TaxId:10090] [141879] (5 PDB entries)
    Uniprot P50172 24-298
  8. 1827087Domain d4nmha_: 4nmh A: [238031]
    automated match to d3pdjb_
    complexed with 2kg, ndp, so4

Details for d4nmha_

PDB Entry: 4nmh (more details), 2.9 Å

PDB Description: 11-beta-HSD1 in complex with a 3,3-Di-methyl-azetidin-2-one
PDB Compounds: (A:) Corticosteroid 11-beta-dehydrogenase isozyme 1

SCOPe Domain Sequences for d4nmha_:

Sequence; same for both SEQRES and ATOM records: (download)

>d4nmha_ c.2.1.2 (A:) 11-beta-hydroxysteroid dehydrogenase 1 {Mouse (Mus musculus) [TaxId: 10090]}
eefrpemlqgkkvivtgaskgigremayhlskmgahvvltarseeglqkvvsrclelgaa
sahyiagtmedmtfaeqfivkagklmggldmlilnhitqtslslfhddihsvrrvmevnf
lsyvvmstaalpmlkqsngsiavisslagkvtypmvapysaskfaldgffstirtelyit
kvnvsitlcvlglidtetamkeisgiinaqaspkeecaleiikgtalrksevyydksplt
pillgnpgrkimeffslryynkdmf

SCOPe Domain Coordinates for d4nmha_:

Click to download the PDB-style file with coordinates for d4nmha_.
(The format of our PDB-style files is described here.)

Timeline for d4nmha_: