SCOPe 2.08: Domain d4nstb1: 4nst B:20-157

Lineage for d4nstb1 (4nst B:20-157)

1. Root: SCOPe 2.08

2. Class a: All alpha proteins [46456] (290 folds)

3. Fold a.74: Cyclin-like [47953] (1 superfamily)
   core: 5 helices; one helix is surrounded by the others

4. Superfamily a.74.1: Cyclin-like [47954] (4 families)
   duplication: consists of two domains of this fold

5. Family a.74.1.0: automated matches [227298] (1 protein)
   not a true family

6. Protein automated matches [227124] (1 species)
   not a true protein

7. Species Human (Homo sapiens) [TaxId:9606] [226765] (9 PDB entries)

8. Domain d4nstb1: 4nst B:20-157 [238028]
   Other proteins in same PDB: d4nsta_, d4nstc_
   automated match to d2pk2a2
   protein/RNA complex; complexed with adp, af3, edo, mg

Details for d4nstb1

PDB Entry: 4nst, 2.2 Å

PDB Description: Crystal structure of human Cdk12/Cyclin K in complex with ADP-aluminum fluoride

PDB Compounds: (B:) cyclin-k

SCOPe Domain Sequences for d4nstb1:

Sequence; same for both SEQRES and ATOM records:

>d4nstb1 a.74.1.0 (B:20-157) automated matches {Human (Homo sapiens) [TaxId: 9606]}
tkpcwywdkkdlahtpsqlegldpatearyrregarfifdvgtrlglhydtlatgiiyfh
rfymfhsfkqfpryvtgacclflagkveetpkkckdiiktarsllndvqfgqfgddpkee
vmvlerillqtikfdlqv

Timeline for d4nstb1:

• d4nstb1 first appeared in SCOPe 2.03
  
• d4nstb1 appears in SCOPe 2.07