Class b: All beta proteins [48724] (180 folds) |
Fold b.22: TNF-like [49841] (1 superfamily) sandwich, 10 strands in 2 sheets; jelly-roll |
Superfamily b.22.1: TNF-like [49842] (2 families) |
Family b.22.1.0: automated matches [191519] (1 protein) not a true family |
Protein automated matches [190873] (4 species) not a true protein |
Species Human (Homo sapiens) [TaxId:9606] [188225] (28 PDB entries) |
Domain d4nn0c1: 4nn0 C:103-239 [238027] Other proteins in same PDB: d4nn0a2, d4nn0b2, d4nn0c2 automated match to d4f3ja_ complexed with act, edo, so4 |
PDB Entry: 4nn0 (more details), 1.42 Å
SCOPe Domain Sequences for d4nn0c1:
Sequence; same for both SEQRES and ATOM records: (download)
>d4nn0c1 b.22.1.0 (C:103-239) automated matches {Human (Homo sapiens) [TaxId: 9606]} rsafsakrsesrvpppsdaplpfdrvlvneqghydavtgkftcqvpgvyyfavhatvyra slqfdlvkngesiasffqffggwpkpaslsggamvrlepedqvwvqvgvgdyigiyasik tdstfsgflvysdwhss
Timeline for d4nn0c1:
View in 3D Domains from other chains: (mouse over for more information) d4nn0a1, d4nn0a2, d4nn0b1, d4nn0b2 |