SCOPe 2.05: Domain d4nn0a_: 4nn0 A:

Lineage for d4nn0a_ (4nn0 A:)

1. Root: SCOPe 2.05

2. Class b: All beta proteins [48724] (176 folds)

3. Fold b.22: TNF-like [49841] (1 superfamily)
   sandwich, 10 strands in 2 sheets; jelly-roll

4. Superfamily b.22.1: TNF-like [49842] (2 families)

5. Family b.22.1.0: automated matches [191519] (1 protein)
   not a true family

6. Protein automated matches [190873] (3 species)
   not a true protein

7. Species Human (Homo sapiens) [TaxId:9606] [188225] (20 PDB entries)

8. Domain d4nn0a_: 4nn0 A: [238026]
   automated match to d4f3ja_
   complexed with act, edo, so4

Details for d4nn0a_

PDB Entry: 4nn0, 1.42 Å

PDB Description: Crystal structure of the C1QTNF5 globular domain in space group P63

PDB Compounds: (A:) Complement C1q tumor necrosis factor-related protein 5

SCOPe Domain Sequences for d4nn0a_:

Sequence; same for both SEQRES and ATOM records:

>d4nn0a_ b.22.1.0 (A:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
arsafsakrsesrvpppsdaplpfdrvlvneqghydavtgkftcqvpgvyyfavhatvyr
aslqfdlvkngesiasffqffggwpkpaslsggamvrlepedqvwvqvgvgdyigiyasi
ktdstfsgflvysdwhs

Timeline for d4nn0a_:

• d4nn0a_ first appeared in SCOPe 2.03
  
• d4nn0a_ appears in SCOPe 2.04
  
• d4nn0a_ is called d4nn0a1 in SCOPe 2.06
  
• d4nn0a_ appears in the current release, SCOPe 2.08, called d4nn0a1