SCOPe 2.08: Domain d4nn0a1: 4nn0 A:103-238

Lineage for d4nn0a1 (4nn0 A:103-238)

1. Root: SCOPe 2.08

2. Class b: All beta proteins [48724] (180 folds)

3. Fold b.22: TNF-like [49841] (1 superfamily)
   sandwich, 10 strands in 2 sheets; jelly-roll

4. Superfamily b.22.1: TNF-like [49842] (2 families)

5. Family b.22.1.0: automated matches [191519] (1 protein)
   not a true family

6. Protein automated matches [190873] (4 species)
   not a true protein

7. Species Human (Homo sapiens) [TaxId:9606] [188225] (28 PDB entries)

8. Domain d4nn0a1: 4nn0 A:103-238 [238026]
   Other proteins in same PDB: d4nn0a2, d4nn0b2, d4nn0c2
   automated match to d4f3ja_
   complexed with act, edo, so4

Details for d4nn0a1

PDB Entry: 4nn0, 1.42 Å

PDB Description: Crystal structure of the C1QTNF5 globular domain in space group P63

PDB Compounds: (A:) Complement C1q tumor necrosis factor-related protein 5

SCOPe Domain Sequences for d4nn0a1:

Sequence; same for both SEQRES and ATOM records:

>d4nn0a1 b.22.1.0 (A:103-238) automated matches {Human (Homo sapiens) [TaxId: 9606]}
rsafsakrsesrvpppsdaplpfdrvlvneqghydavtgkftcqvpgvyyfavhatvyra
slqfdlvkngesiasffqffggwpkpaslsggamvrlepedqvwvqvgvgdyigiyasik
tdstfsgflvysdwhs

Timeline for d4nn0a1:

• d4nn0a1 first appeared in SCOPe 2.03, called d4nn0a_
  
• d4nn0a1 appears in SCOPe 2.07