SCOPe 2.08: Domain d4m6ml1: 4m6m L:1-112

Lineage for d4m6ml1 (4m6m L:1-112)

1. Root: SCOPe 2.08

2. Class b: All beta proteins [48724] (180 folds)

3. Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
   sandwich; 7 strands in 2 sheets; greek-key
   some members of the fold have additional strands

4. Superfamily b.1.1: Immunoglobulin [48726] (5 families)

5. Family b.1.1.0: automated matches [191470] (1 protein)
   not a true family

6. Protein automated matches [190740] (31 species)
   not a true protein

7. Species Human (Homo sapiens) [TaxId:9606] [187920] (1793 PDB entries)

8. Domain d4m6ml1: 4m6m L:1-112 [238023]
   Other proteins in same PDB: d4m6ml2
   automated match to d2mcg11
   complexed with gol, mla, peg

Details for d4m6ml1

PDB Entry: 4m6m, 2 Å

PDB Description: crystal structure of anti-il-23 antibody cnto1959 at ph 9.5

PDB Compounds: (L:) CNTO1959 light chain

SCOPe Domain Sequences for d4m6ml1:

Sequence; same for both SEQRES and ATOM records:

>d4m6ml1 b.1.1.0 (L:1-112) automated matches {Human (Homo sapiens) [TaxId: 9606]}
qsvltqppsvsgapgqrvtisctgsssnigsgydvhwyqqlpgtapklliygnskrpsgv
pdrfsgsksgtsaslaitglqsedeadyycaswtdglslvvfgggtkltvlg

Timeline for d4m6ml1:

• d4m6ml1 first appeared in SCOPe 2.03
  
• d4m6ml1 appears in SCOPe 2.07