![]() | Class b: All beta proteins [48724] (180 folds) |
![]() | Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies) sandwich; 7 strands in 2 sheets; greek-key some members of the fold have additional strands |
![]() | Superfamily b.1.1: Immunoglobulin [48726] (5 families) ![]() |
![]() | Family b.1.1.0: automated matches [191470] (1 protein) not a true family |
![]() | Protein automated matches [190740] (31 species) not a true protein |
![]() | Species Rabbit (Oryctolagus cuniculus) [TaxId:9986] [225523] (30 PDB entries) |
![]() | Domain d4ma3a2: 4ma3 A:113-219 [238020] automated match to d3ngbc2 complexed with act, so4 |
PDB Entry: 4ma3 (more details), 2 Å
SCOPe Domain Sequences for d4ma3a2:
Sequence; same for both SEQRES and ATOM records: (download)
>d4ma3a2 b.1.1.0 (A:113-219) automated matches {Rabbit (Oryctolagus cuniculus) [TaxId: 9986]} vrtvaapsvfifppsdeqlksgtasvvcllnnfypreakvqwkvdnalqsgnsqesvteq dskdstyslsstltlskadyekhkvyacevthqglsspvtksfnrge
Timeline for d4ma3a2:
![]() Domains from other chains: (mouse over for more information) d4ma3b_, d4ma3h_, d4ma3l1, d4ma3l2 |