SCOPe 2.08: Domain d4maul2: 4mau L:112-216

Lineage for d4maul2 (4mau L:112-216)

1. Root: SCOPe 2.08

2. Class b: All beta proteins [48724] (180 folds)

3. Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
   sandwich; 7 strands in 2 sheets; greek-key
   some members of the fold have additional strands

4. Superfamily b.1.1: Immunoglobulin [48726] (5 families)

5. Family b.1.1.2: C1 set domains (antibody constant domain-like) [48942] (24 proteins)

6. Protein automated matches [190374] (15 species)
   not a true protein

7. Species Mouse (Mus musculus) [TaxId:10090] [224855] (650 PDB entries)

8. Domain d4maul2: 4mau L:112-216 [238017]
   Other proteins in same PDB: d4mauh_, d4maul1
   automated match to d1n0xl2
   complexed with fmt, gol, so4

Details for d4maul2

PDB Entry: 4mau, 1.9 Å

PDB Description: Crystal structure of anti-ST2L antibody C2244

PDB Compounds: (L:) C2244 light chain

SCOPe Domain Sequences for d4maul2:

Sequence; same for both SEQRES and ATOM records:

>d4maul2 b.1.1.2 (L:112-216) automated matches {Mouse (Mus musculus) [TaxId: 10090]}
rtvaapsvfifppsdeqlksgtasvvcllnnfypreakvqwkvdnalqsgnsqesvteqd
skdstyslsstltlskadyekhkvyacevthqglsspvtksfnrg

Timeline for d4maul2:

• d4maul2 first appeared in SCOPe 2.03
  
• d4maul2 appears in SCOPe 2.07