Lineage for d4mp0c_ (4mp0 C:)

  1. Root: SCOPe 2.08
  2. 2923792Class d: Alpha and beta proteins (a+b) [53931] (396 folds)
  3. 2998036Fold d.159: Metallo-dependent phosphatases [56299] (1 superfamily)
    4 layers: alpha/beta/beta/alpha; mixed beta sheets; contains duplication
  4. 2998037Superfamily d.159.1: Metallo-dependent phosphatases [56300] (13 families) (S)
    different families of this superfamily are groupped in a single Pfam family, Pfam PF00149
  5. 2998136Family d.159.1.3: Protein serine/threonine phosphatase [56310] (6 proteins)
  6. 2998162Protein Protein phosphatase-1 (PP-1) [56311] (6 species)
  7. 2998163Species Human (Homo sapiens) [TaxId:9606] [188651] (5 PDB entries)
  8. 2998171Domain d4mp0c_: 4mp0 C: [238011]
    Other proteins in same PDB: d4mp0a2
    automated match to d3e7ba_
    complexed with gol, mn, po4

Details for d4mp0c_

PDB Entry: 4mp0 (more details), 2.1 Å

PDB Description: Structure of a second nuclear PP1 Holoenzyme, crystal form 2
PDB Compounds: (C:) Serine/threonine-protein phosphatase PP1-alpha catalytic subunit

SCOPe Domain Sequences for d4mp0c_:

Sequence; same for both SEQRES and ATOM records: (download)

>d4mp0c_ d.159.1.3 (C:) Protein phosphatase-1 (PP-1) {Human (Homo sapiens) [TaxId: 9606]}
lnldsiigrllevqgsrpgknvqlteneirglclksreiflsqpilleleaplkicgdih
gqyydllrlfeyggfppesnylflgdyvdrgkqsleticlllaykikypenffllrgnhe
casinriygfydeckrryniklwktftdcfnclpiaaivdekifcchgglspdlqsmeqi
rrimrptdvpdqgllcdllwsdpdkdvqgwgendrgvsftfgaevvakflhkhdldlicr
ahqvvedgyeffakrqlvtlfsapnycgefdnagammsvdetlmcsfqilk

SCOPe Domain Coordinates for d4mp0c_:

Click to download the PDB-style file with coordinates for d4mp0c_.
(The format of our PDB-style files is described here.)

Timeline for d4mp0c_: