SCOPe 2.08: Domain d4mg3a_: 4mg3 A:

Lineage for d4mg3a_ (4mg3 A:)

1. Root: SCOPe 2.08

2. Class b: All beta proteins [48724] (180 folds)

3. Fold b.47: Trypsin-like serine proteases [50493] (1 superfamily)
   barrel, closed; n=6, S=8; greek-key
   duplication: consists of two domains of the same fold

4. Superfamily b.47.1: Trypsin-like serine proteases [50494] (5 families)

5. Family b.47.1.0: automated matches [191364] (1 protein)
   not a true family

6. Protein automated matches [190438] (36 species)
   not a true protein

7. Species Coxsackievirus a16 [TaxId:231417] [238004] (1 PDB entry)

8. Domain d4mg3a_: 4mg3 A: [238005]
   automated match to d4fvba_
   complexed with 1pe, trs, zn

Details for d4mg3a_

PDB Entry: 4mg3, 1.8 Å

PDB Description: crystal structural analysis of 2a protease from coxsackievirus a16

PDB Compounds: (A:) Protease 2A

SCOPe Domain Sequences for d4mg3a_:

Sequence; same for both SEQRES and ATOM records:

>d4mg3a_ b.47.1.0 (A:) automated matches {Coxsackievirus a16 [TaxId: 231417]}
gqqsgaiyvgnyrvvnrhlathndwanlvwedssrdllvssttaqgcdtiarcncqtgvy
ycsskrkhypvsftkpslifveaseyyparyqshlmlavghsepgdcggilrcqhgvvgi
vstggnglvgfadvrdllwlde

Timeline for d4mg3a_:

• d4mg3a_ first appeared in SCOPe 2.03
  
• d4mg3a_ appears in SCOPe 2.07