Class b: All beta proteins [48724] (174 folds) |
Fold b.1: Immunoglobulin-like beta-sandwich [48725] (28 superfamilies) sandwich; 7 strands in 2 sheets; greek-key some members of the fold have additional strands |
Superfamily b.1.1: Immunoglobulin [48726] (5 families) |
Family b.1.1.2: C1 set domains (antibody constant domain-like) [48942] (24 proteins) |
Protein automated matches [190374] (12 species) not a true protein |
Species Mus musculus, [TaxId:10090] [237991] (4 PDB entries) |
Domain d4kuzl2: 4kuz L:113-216 [237995] Other proteins in same PDB: d4kuzl1 automated match to d1n0xl2 complexed with so4 |
PDB Entry: 4kuz (more details), 2.7 Å
SCOPe Domain Sequences for d4kuzl2:
Sequence; same for both SEQRES and ATOM records: (download)
>d4kuzl2 b.1.1.2 (L:113-216) automated matches {Mus musculus, [TaxId: 10090]} rtvaapsvfifppsdeqlksgtasvvcllnnfypreakvqwkvdnalqsgnsqesvteqd skdstyslsstltlskadyekhkvyacevthqglsspvtksfnr
Timeline for d4kuzl2: