SCOPe 2.06: Domain d4lm4a1: 4lm4 A:449-775

Lineage for d4lm4a1 (4lm4 A:449-775)

1. Root: SCOPe 2.06

2. Class a: All alpha proteins [46456] (289 folds)

3. Fold a.211: HD-domain/PDEase-like [109603] (1 superfamily)
   multihelical; consists of two different alpha-helical bundles

4. Superfamily a.211.1: HD-domain/PDEase-like [109604] (6 families)

5. Family a.211.1.0: automated matches [191566] (1 protein)
   not a true family

6. Protein automated matches [190983] (9 species)
   not a true protein

7. Species Human (Homo sapiens) [TaxId:9606] [188676] (111 PDB entries)

8. Domain d4lm4a1: 4lm4 A:449-775 [237993]
   Other proteins in same PDB: d4lm4a2, d4lm4b2
   automated match to d4lkqb_
   complexed with jpz, ni

Details for d4lm4a1

PDB Entry: 4lm4, 1.48 Å

PDB Description: Crystal structure of PDE10A2 with fragment ZT902

PDB Compounds: (A:) cAMP and cAMP-inhibited cGMP 3',5'-cyclic phosphodiesterase 10A

SCOPe Domain Sequences for d4lm4a1:

Sequence; same for both SEQRES and ATOM records:

>d4lm4a1 a.211.1.0 (A:449-775) automated matches {Human (Homo sapiens) [TaxId: 9606]}
sictseewqglmqftlpvrlckeielfhfdigpfenmwpgifvymvhrscgtscfelekl
crfimsvkknyrrvpyhnwkhavtvahcmyailqnnhtlftdlerkglliaclchdldhr
gfsnsylqkfdhplaalyststmeqhhfsqtvsilqleghnifstlssseyeqvleiirk
aiiatdlalyfgnrkqleemyqtgslnlnnqshrdrviglmmtacdlcsvtklwpvtklt
andiyaefwaegdemkklgiqpipmmdrdkkdevpqgqlgfynavaipcyttltqilppt
epllkacrdnlsqwekvirgeetatwi

Timeline for d4lm4a1:

• d4lm4a1 first appeared in SCOPe 2.03, called d4lm4a_
  
• d4lm4a1 was called d4lm4a_ in SCOPe 2.05
  
• d4lm4a1 appears in SCOPe 2.07
  
• d4lm4a1 appears in the current release, SCOPe 2.08