Lineage for d4kq4l1 (4kq4 L:1-107)

  1. Root: SCOPe 2.08
  2. 2739516Class b: All beta proteins [48724] (180 folds)
  3. 2739517Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 2739518Superfamily b.1.1: Immunoglobulin [48726] (5 families) (S)
  5. 2754035Family b.1.1.0: automated matches [191470] (1 protein)
    not a true family
  6. 2754036Protein automated matches [190740] (31 species)
    not a true protein
  7. 2759478Species Mouse (Mus musculus) [TaxId:10090] [188198] (836 PDB entries)
  8. 2760500Domain d4kq4l1: 4kq4 L:1-107 [237990]
    Other proteins in same PDB: d4kq4h2, d4kq4h3, d4kq4l2
    automated match to d1n0xl1
    complexed with ni

Details for d4kq4l1

PDB Entry: 4kq4 (more details), 2.45 Å

PDB Description: Crystal structure of Anti-IL-17A antibody CNTO7357
PDB Compounds: (L:) CNTO7357 light chain

SCOPe Domain Sequences for d4kq4l1:

Sequence; same for both SEQRES and ATOM records: (download)

>d4kq4l1 b.1.1.0 (L:1-107) automated matches {Mouse (Mus musculus) [TaxId: 10090]}
divmtqshkfmstsvgdrvsitckasqdvstavawyqqkpgqspklliywastrhtgvpd
rftgsgsgtdytltissvqaedlalyycqqhystpytfgggtkleik

SCOPe Domain Coordinates for d4kq4l1:

Click to download the PDB-style file with coordinates for d4kq4l1.
(The format of our PDB-style files is described here.)

Timeline for d4kq4l1: