SCOPe 2.08: Domain d4llxb1: 4llx B:449-774

Lineage for d4llxb1 (4llx B:449-774)

1. Root: SCOPe 2.08

2. Class a: All alpha proteins [46456] (290 folds)

3. Fold a.211: HD-domain/PDEase-like [109603] (1 superfamily)
   multihelical; consists of two different alpha-helical bundles

4. Superfamily a.211.1: HD-domain/PDEase-like [109604] (9 families)

5. Family a.211.1.0: automated matches [191566] (1 protein)
   not a true family

6. Protein automated matches [190983] (12 species)
   not a true protein

7. Species Human (Homo sapiens) [TaxId:9606] [188676] (139 PDB entries)

8. Domain d4llxb1: 4llx B:449-774 [237983]
   Other proteins in same PDB: d4llxa2, d4llxb2
   automated match to d4lkqb_
   complexed with 5ze, ni

Details for d4llxb1

PDB Entry: 4llx, 1.75 Å

PDB Description: Crystal structure of PDE10A2 with fragment ZT434

PDB Compounds: (B:) cAMP and cAMP-inhibited cGMP 3',5'-cyclic phosphodiesterase 10A

SCOPe Domain Sequences for d4llxb1:

Sequence; same for both SEQRES and ATOM records:

>d4llxb1 a.211.1.0 (B:449-774) automated matches {Human (Homo sapiens) [TaxId: 9606]}
sictseewqglmqftlpvrlckeielfhfdigpfenmwpgifvymvhrscgtscfelekl
crfimsvkknyrrvpyhnwkhavtvahcmyailqnnhtlftdlerkglliaclchdldhr
gfsnsylqkfdhplaalyststmeqhhfsqtvsilqleghnifstlssseyeqvleiirk
aiiatdlalyfgnrkqleemyqtgslnlnnqshrdrviglmmtacdlcsvtklwpvtklt
andiyaefwaegdemkklgiqpipmmdrdkkdevpqgqlgfynavaipcyttltqilppt
epllkacrdnlsqwekvirgeetatw

Timeline for d4llxb1:

• d4llxb1 first appeared in SCOPe 2.03, called d4llxb_
  
• d4llxb1 appears in SCOPe 2.07