Lineage for d4lljb_ (4llj B:)

  1. Root: SCOPe 2.03
  2. 1253684Class a: All alpha proteins [46456] (284 folds)
  3. 1285679Fold a.211: HD-domain/PDEase-like [109603] (1 superfamily)
    multihelical; consists of two different alpha-helical bundles
  4. 1285680Superfamily a.211.1: HD-domain/PDEase-like [109604] (6 families) (S)
  5. 1286061Family a.211.1.0: automated matches [191566] (1 protein)
    not a true family
  6. 1286062Protein automated matches [190983] (4 species)
    not a true protein
  7. 1286063Species Human (Homo sapiens) [TaxId:9606] [188676] (34 PDB entries)
  8. 1286078Domain d4lljb_: 4llj B: [237980]
    automated match to d4lkqb_
    complexed with 1xn, ni

Details for d4lljb_

PDB Entry: 4llj (more details), 1.56 Å

PDB Description: Crystal structure of PDE10A2 with fragment ZT214
PDB Compounds: (B:) cAMP and cAMP-inhibited cGMP 3',5'-cyclic phosphodiesterase 10A

SCOPe Domain Sequences for d4lljb_:

Sequence, based on SEQRES records: (download)

>d4lljb_ a.211.1.0 (B:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
tsictseewqglmqftlpvrlckeielfhfdigpfenmwpgifvymvhrscgtscfelek
lcrfimsvkknyrrvpyhnwkhavtvahcmyailqnnhtlftdlerkglliaclchdldh
rgfsnsylqkfdhplaalyststmeqhhfsqtvsilqleghnifstlssseyeqvleiir
kaiiatdlalyfgnrkqleemyqtgslnlnnqshrdrviglmmtacdlcsvtklwpvtkl
tandiyaefwaegdemkklgiqpipmmdrdkkdevpqgqlgfynavaipcyttltqilpp
tepllkacrdnlsqwekvirgeeta

Sequence, based on observed residues (ATOM records): (download)

>d4lljb_ a.211.1.0 (B:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
tsictseewqglmqftlpvrlckeielfhfdigpfenmwpgifvymvhrscgtscfelek
lcrfimsvkknyrrvpyhnwkhavtvahcmyailqnnhtlftdlerkglliaclchdldh
rgfsnsylqkflaalyststmeqhhfsqtvsilqleghnifstlssseyeqvleiirkai
iatdlalyfgnrkqleemyqtgslnlnnqshrdrviglmmtacdlcsvtklwpvtkltan
diyaefwaegdemkklgiqpipmmdrdkkdevpqgqlgfynavaipcyttltqilpptep
llkacrdnlsqwekvirgeeta

SCOPe Domain Coordinates for d4lljb_:

Click to download the PDB-style file with coordinates for d4lljb_.
(The format of our PDB-style files is described here.)

Timeline for d4lljb_:

  • d4lljb_ appears in periodic updates to SCOPe 2.03 starting on 2014-03-26
  • d4lljb_ appears in SCOPe 2.04
  • d4lljb_ appears in the current release, SCOPe 2.07, called d4lljb1