![]() | Class b: All beta proteins [48724] (180 folds) |
![]() | Fold b.60: Lipocalins [50813] (1 superfamily) barrel, closed or opened; n=8, S=12; meander |
![]() | Superfamily b.60.1: Lipocalins [50814] (10 families) ![]() bind hydrophobic ligands in their interior |
![]() | Family b.60.1.2: Fatty acid binding protein-like [50847] (18 proteins) ten-stranded meander beta-sheet folded upon itself relates to the common fold by opening the barrel and insertion of beta-hairpin |
![]() | Protein Epidermal fatty acid binding protein [50854] (1 species) |
![]() | Species Human (Homo sapiens) [TaxId:9606] [50855] (6 PDB entries) |
![]() | Domain d4lkpa_: 4lkp A: [237974] automated match to d1lida_ complexed with cl, dms, nh4, so4 |
PDB Entry: 4lkp (more details), 1.67 Å
SCOPe Domain Sequences for d4lkpa_:
Sequence; same for both SEQRES and ATOM records: (download)
>d4lkpa_ b.60.1.2 (A:) Epidermal fatty acid binding protein {Human (Homo sapiens) [TaxId: 9606]} atvqqlegrwrlvdskgfdeymkelgvgialrkmgamakpdciitcdgknltiktestlk ttqfsctlgekfeettadgrktqtvcnftdgalvqhqewdgkestitrklkdgklvvecv mnnvtctriyekve
Timeline for d4lkpa_: