![]() | Class a: All alpha proteins [46456] (290 folds) |
![]() | Fold a.3: Cytochrome c [46625] (1 superfamily) core: 3 helices; folded leaf, opened |
![]() | Superfamily a.3.1: Cytochrome c [46626] (9 families) ![]() covalently-bound heme completes the core |
![]() | Family a.3.1.0: automated matches [191374] (1 protein) not a true family |
![]() | Protein automated matches [190453] (26 species) not a true protein |
![]() | Species Synechococcus sp. [TaxId:84588] [237969] (1 PDB entry) |
![]() | Domain d4kmga_: 4kmg A: [237970] automated match to d1ls9a_ complexed with hec, na |
PDB Entry: 4kmg (more details), 1.4 Å
SCOPe Domain Sequences for d4kmga_:
Sequence; same for both SEQRES and ATOM records: (download)
>d4kmga_ a.3.1.0 (A:) automated matches {Synechococcus sp. [TaxId: 84588]} etsgegavlfgqhcagchvnggniirrgknlklatlkrqgldsteaiasiarkgigqmsg ygdklgeggdqlvagwileqaqnawtqg
Timeline for d4kmga_: