Lineage for d4kmga_ (4kmg A:)

  1. Root: SCOPe 2.08
  2. 2685877Class a: All alpha proteins [46456] (290 folds)
  3. 2690796Fold a.3: Cytochrome c [46625] (1 superfamily)
    core: 3 helices; folded leaf, opened
  4. 2690797Superfamily a.3.1: Cytochrome c [46626] (9 families) (S)
    covalently-bound heme completes the core
  5. 2691615Family a.3.1.0: automated matches [191374] (1 protein)
    not a true family
  6. 2691616Protein automated matches [190453] (26 species)
    not a true protein
  7. 2691755Species Synechococcus sp. [TaxId:84588] [237969] (1 PDB entry)
  8. 2691756Domain d4kmga_: 4kmg A: [237970]
    automated match to d1ls9a_
    complexed with hec, na

Details for d4kmga_

PDB Entry: 4kmg (more details), 1.4 Å

PDB Description: crystal structure of cytochrome c6b from synechococcus sp. wh8102
PDB Compounds: (A:) Cytochrome C6 (Soluble cytochrome F) (Cytochrome c553)

SCOPe Domain Sequences for d4kmga_:

Sequence; same for both SEQRES and ATOM records: (download)

>d4kmga_ a.3.1.0 (A:) automated matches {Synechococcus sp. [TaxId: 84588]}
etsgegavlfgqhcagchvnggniirrgknlklatlkrqgldsteaiasiarkgigqmsg
ygdklgeggdqlvagwileqaqnawtqg

SCOPe Domain Coordinates for d4kmga_:

Click to download the PDB-style file with coordinates for d4kmga_.
(The format of our PDB-style files is described here.)

Timeline for d4kmga_: