Lineage for d2viua_ (2viu A:)

  1. Root: SCOP 1.57
  2. 51639Class b: All beta proteins [48724] (104 folds)
  3. 57292Fold b.19: Viral protein domain [49817] (1 superfamily)
  4. 57293Superfamily b.19.1: Viral protein domain [49818] (3 families) (S)
  5. 57323Family b.19.1.2: Influenza hemagglutinin headpice [49823] (1 protein)
  6. 57324Protein Hemagglutinin [49824] (1 species)
  7. 57325Species Influenza A virus, different strains [TaxId:11320] [49825] (24 PDB entries)
  8. 57331Domain d2viua_: 2viu A: [23797]
    Other proteins in same PDB: d2viub_

Details for d2viua_

PDB Entry: 2viu (more details), 2.5 Å

PDB Description: influenza virus hemagglutinin
PDB Compounds: (A:)

SCOP Domain Sequences for d2viua_:

Sequence; same for both SEQRES and ATOM records: (download)

>d2viua_ b.19.1.2 (A:) Hemagglutinin {Influenza A virus, different strains}
statlclghhavpngtlvktitddqievtnatelvqssstgkicnnphrildgidctlid
allgdphcdvfqnetwdlfverskafsncypydvpdyaslrslvassgtlefitegftwt
gviqnggsnackrgpgsgffsrlnwltksgstypvlnvtmpnndnfdklyiwgihhpstn
qeqtslyvqasgrvtvstrrsqqtiipnigsrpwvrglssrisiywtivkpgdvlvinsn
gnliaprgyfkmrtgkssimrsdapidtcisecitpngsipndkpfqnvnkitygacpky
vkqntlklatgmrnvpekqt

SCOP Domain Coordinates for d2viua_:

Click to download the PDB-style file with coordinates for d2viua_.
(The format of our PDB-style files is described here.)

Timeline for d2viua_: