Lineage for d4kjtb_ (4kjt B:)

  1. Root: SCOPe 2.06
  2. 1976409Class a: All alpha proteins [46456] (289 folds)
  3. 1976410Fold a.1: Globin-like [46457] (2 superfamilies)
    core: 6 helices; folded leaf, partly opened
  4. 1976411Superfamily a.1.1: Globin-like [46458] (5 families) (S)
  5. 1976488Family a.1.1.2: Globins [46463] (27 protein domains)
    Heme-binding protein
  6. 1976528Protein Dehaloperoxidase [46530] (1 species)
  7. 1976529Species Amphitrite ornata [TaxId:129555] [46531] (31 PDB entries)
  8. 1976549Domain d4kjtb_: 4kjt B: [237968]
    automated match to d4hsxb_
    complexed with edo, hem, oxy, so4; mutant

Details for d4kjtb_

PDB Entry: 4kjt (more details), 1.44 Å

PDB Description: structure of the l100f mutant of dehaloperoxidase-hemoglobin a from amphitrite ornata with oxygen
PDB Compounds: (B:) Dehaloperoxidase A

SCOPe Domain Sequences for d4kjtb_:

Sequence; same for both SEQRES and ATOM records: (download)

>d4kjtb_ a.1.1.2 (B:) Dehaloperoxidase {Amphitrite ornata [TaxId: 129555]}
gfkqdiatirgdlrtyaqdiflaflnkypderryfknyvgksdqelksmakfgdhtekvf
nlmmevadratdcvplasdantlvqmkqhsslttgnfekffvalveymrasgqsfdsqsw
drfgknlvsalssagmk

SCOPe Domain Coordinates for d4kjtb_:

Click to download the PDB-style file with coordinates for d4kjtb_.
(The format of our PDB-style files is described here.)

Timeline for d4kjtb_: