![]() | Class a: All alpha proteins [46456] (290 folds) |
![]() | Fold a.1: Globin-like [46457] (2 superfamilies) core: 6 helices; folded leaf, partly opened |
![]() | Superfamily a.1.1: Globin-like [46458] (5 families) ![]() |
![]() | Family a.1.1.2: Globins [46463] (27 proteins) Heme-binding protein |
![]() | Protein Dehaloperoxidase [46530] (1 species) |
![]() | Species Amphitrite ornata [TaxId:129555] [46531] (32 PDB entries) |
![]() | Domain d4kjta_: 4kjt A: [237967] automated match to d4hsxb_ complexed with edo, hem, oxy, so4; mutant |
PDB Entry: 4kjt (more details), 1.44 Å
SCOPe Domain Sequences for d4kjta_:
Sequence; same for both SEQRES and ATOM records: (download)
>d4kjta_ a.1.1.2 (A:) Dehaloperoxidase {Amphitrite ornata [TaxId: 129555]} gfkqdiatirgdlrtyaqdiflaflnkypderryfknyvgksdqelksmakfgdhtekvf nlmmevadratdcvplasdantlvqmkqhsslttgnfekffvalveymrasgqsfdsqsw drfgknlvsalssagmk
Timeline for d4kjta_: