![]() | Class b: All beta proteins [48724] (178 folds) |
![]() | Fold b.19: Viral protein domain [49817] (1 superfamily) sandwich; 9 strands in 2 sheets; jelly-roll; form trimers |
![]() | Superfamily b.19.1: Viral protein domain [49818] (4 families) ![]() forms homotrimers |
![]() | Family b.19.1.1: Top domain of virus capsid protein [49819] (3 proteins) this domain is inserted into a multihelical domain |
![]() | Protein RDV p8, central (top) domain [100924] (2 species) |
![]() | Species African horse sickness virus [TaxId:40050] [49822] (1 PDB entry) |
![]() | Domain d1ahsb_: 1ahs B: [23795] |
PDB Entry: 1ahs (more details), 2.3 Å
SCOPe Domain Sequences for d1ahsb_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1ahsb_ b.19.1.1 (B:) RDV p8, central (top) domain {African horse sickness virus [TaxId: 40050]} tgpyagavevqqsgryyvpqgrtrggyinsniaevcmdagaagqvnallaprrgdavmiy fvwrplrifcdpqgaslesapgtfvtvdgvnvaagdvvawntiapvnvgnpgarrsilqf evlwyt
Timeline for d1ahsb_: